Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Mitochondrial ROS Detection Assay Kit
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid A4 Protein Precursor (740-770), APP (C31) - ANA62073 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)
print page
Size: 1 mg
£360.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62073
Name:
Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)
Supplier:
Availability:

This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3717.1
Reference:
Chen, Y. et al. J. Cell Biol. 163, 27 (2003); Lu, D. et al. Nat. Med. 6, 397 (2000).
UNSPSC Code:
12352202
Contact Our Customer Service Team