Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Same Day Delivered Fresh Human Blood
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human - ANA62068 - 1 mg - AnaSpec - proteins & peptides

GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human
print page
Size: 1 mg
£423.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62068
Name:
GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human
Supplier:
Availability:

Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3922.4
Reference:
Yusta, B. et al. J Biol Chem 274, 30459 (1999)Drucker, D. Gastroenterol 122, 531 (2002).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team