Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Lyophilised Exosome Standards - ExoStd™
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

Glucagon-like Peptide-2, GLP-2 (146-178), human - ANA62070 - 1 mg - AnaSpec - proteins & peptides

Glucagon-like Peptide-2, GLP-2 (146-178), human
print page
Size: 1 mg
£400.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62070
Name:
Glucagon-like Peptide-2, GLP-2 (146-178), human
Supplier:
Availability:

This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3766.2
Reference:
Cameron, H. et al. JPET 314, 214 (2005).
UNSPSC Code:
12352202
Contact Our Customer Service Team