Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Vector Shuttling & Clone Modification Service

Highly effective & efficient in vitro delivery of Cas9 RNP for genome editing in challenging cells

C34, gp41 HIV Fragment - ANA62101 - 1 mg - AnaSpec - proteins & peptides

C34, gp41 HIV Fragment
print page
Size: 1 mg
£423.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62101
Name:
C34, gp41 HIV Fragment
Supplier:
Availability:

This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4248.6
Reference:
Bianchi, E. et al. PNAS 102, 12903 (2005), Frey, G. et al. PNAS 103, 13938 (2006), Rosny, E. et al. J. Virol. 78, 2627 (2004).
UNSPSC Code:
12352202
Contact Our Customer Service Team
Lena Biosciences
Tonbo Biosciences