Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Fast Scalable Exosome Isolation From Tissue Culture Media

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

 

Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled, Human - ANA60491-01 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled, Human
print page
Size: 0.1 mg
£290.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60491-01
Name:
Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled, Human
Supplier:
Availability:

This is a fluorescent (HiLyte™ Fluor 488)-labeled β-Amyloid peptide, Abs/Em=503/528 nm.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HiLyte™ Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4686.3
UNSPSC Code:
12352202
Contact Our Friendly Technical Team