Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Locus-Specific 5-mC Analysis - MethylCheck™
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid (1-40), TAMRA-labeled, Human - ANA60488-01 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40), TAMRA-labeled, Human
print page
Size: 0.1 mg
£290.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60488-01
Name:
Beta-Amyloid (1-40), TAMRA-labeled, Human
Supplier:
Availability:

This is a fluorescent (TAMRA)-labeled β-Amyloid peptide, Abs/Em=544/572 nm.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4742.4
UNSPSC Code:
12352202
Tonbo Biosciences