Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Highly Characterised Polyclonal Antibodies
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

 

Adrenomedullin (1-50), rat - ANA60454 - 0.5 mg - AnaSpec - proteins & peptides

Adrenomedullin (1-50), rat
print page
Size: 0.5 mg
£442.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60454
Name:
Adrenomedullin (1-50), rat
Supplier:
Availability:

Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
5729.5
Reference:
Ref: Belloni, AS. et al. Life Sci. 63, 2313 (1998); Sone, M. et al. Peptides 18, 1125 (1997).
UNSPSC Code:
12352202
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents
Tonbo Biosciences