Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Fixable & Non-Fixable Neuronal Terminal Dyes

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

 

Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled, Human - ANA60492-01 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled, Human
print page
Size: 0.1 mg
£290.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60492-01
Name:
Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled, Human
Supplier:
Availability:

This is a fluorescent (HiLyte™ Fluor 555)-labeled β-Amyloid peptide, Abs/Em=551/567 nm. HiLyte™ Fluor 555 labeled Aβ (1-40) is more photostable than Cy3®-labeled Aβ (1-40).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HiLyte™ Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
5182.31
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents