Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Specific STING Proteins

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

Beta-Amyloid (1-40), Human - ANA24236 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40), Human
print page
Size: 1 mg
£290.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24236
Name:
Beta-Amyloid (1-40), Human
Supplier:
Availability:

Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4329.9
Reference:
Ref: Masters, CL. et al. Proc. Natl. Acad. Sci. USA 82, 4245 (1985); Yankner, BA. Neuron 16, 921 (1996); Geula, C. et al. Nat. Med. 4, 827 (1998); Shin, R. et al. J. Neurosci.17, 8187 (1997).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents