Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Quick, High Quality Total DNA Purification Kits
Over 40,000 Peptides & Proteins Available

Beta-Amyloid (1-38), Human - ANA24234 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-38), Human
print page
Size: 1 mg
£355.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24234
Name:
Beta-Amyloid (1-38), Human
Supplier:
Availability:

Beta-Amyloid (1-38)

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Storage Temp:
-20°C
Molecular Weight:
4131.6
UNSPSC Code:
12352202