Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Powerful RNA Extraction From FFPE Samples

Upgrading Your Laser Scanner? Consider The Sapphire™

Parathyroid Hormone (1-34)-Lys(Biotin), human - ANA23647 - 1 mg - AnaSpec - proteins & peptides

Parathyroid Hormone (1-34)-Lys(Biotin), human
print page
Size: 1 mg
£797.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23647
Name:
Parathyroid Hormone (1-34)-Lys(Biotin), human
Supplier:
Availability:

Parathyroid Hormone (1-34)-Lys(Biotin), human - 1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4472.2
UNSPSC Code:
12352202
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents