Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Locus & Sequence Specific 5-hmC Quantification Kits

Upgrading Your Laser Scanner? Consider The Sapphire™

PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat - ANA23648 - 0.5 mg - AnaSpec - proteins & peptides

PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat
print page
Size: 0.5 mg
£529.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23648
Name:
PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat
Supplier:
Availability:

Pituitary Adenylate Cyclase Activating Peptides (PACAPS)

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4888.8
UNSPSC Code:
12352202
Contact Our Friendly Technical Team