Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
TransIT-Lenti

Highly effective & efficient in vitro delivery of Cas9 RNP for genome editing in challenging cells

Cys-beta-Amyloid (1-42), Human - ANA23537 - 0.5 mg - AnaSpec - proteins & peptides

Cys-beta-Amyloid (1-42), Human
print page
Size: 0.5 mg
£861.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23537
Name:
Cys-beta-Amyloid (1-42), Human
Supplier:
Availability:

Beta-Amyloid (1-42) and Related Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4617.3
UNSPSC Code:
12352202
Contact Our Friendly Technical Team