Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Human Cell Expressed Proteins

Transfection Ready Plasmid DNA In 20 Minutes With ZymoPURE II

Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled - ANA23607 - 1 mg - AnaSpec - proteins & peptides

Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled
print page
Size: 1 mg
£689.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23607
Name:
Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled
Supplier:
Availability:

This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-cat# AS-22462-and small amounts of glycine-extended GLP-1 (7-37)-cat# AS-20761. Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Species Reactivity:
Immunogen:
Storage Temp:
-20°C
Antibody Host:
Antibody Isotype:
Antibody Type:
Clone Number:
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4469.8
Material Safety Data Sheet:
Reference:
Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999)Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7.
Sample Type:
Structure:
UNSPSC Code:
12352202
Contact Our Friendly Technical Team