Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:

Frozen Human Plasma

Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human - ANA61261 - 0.5 mg - AnaSpec - proteins & peptides

[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human
print page
Size: 0.5 mg
£239.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61261
Name:
[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human
Supplier:
Availability:

[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human - 0.5 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4328.9
UNSPSC Code:
12352202
Contact Our Customer Service Team