Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Ion Channel Screening & Profiling Services
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human - ANA61261 - 0.5 mg - AnaSpec - proteins & peptides

[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human
print page
Size: 0.5 mg
£258.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61261
Name:
[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human
Supplier:
Availability:

Beta-Amyloid (1-40) and Related Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4328.9
UNSPSC Code:
12352202
Contact Our Customer Service Team