Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Unique Cell Separation Technology
Find Your Peptide Simply with Our Peptide Search

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

LL-37, Antimicrobial Peptide, human - ANA61302 - 1 mg - AnaSpec - proteins & peptides

LL-37, Antimicrobial Peptide, human
print page
Size: 1 mg
£236.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61302
Name:
LL-37, Antimicrobial Peptide, human
Supplier:
Availability:

Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
[LL-37, 37 aa]
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4493.3
Reference:
Dürr, UHN. et al. Biochim. Biophys. Acta 1758, 1408 (2006); Neville, F. et al. Biophys. J. 90, 1275 (2006); Oren, Z. et al. Biochem. J. 341, 501(1999).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents