Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
HostZERO
Find Your Peptide Simply with Our Peptide Search

Highly effective & efficient in vitro delivery of Cas9 RNP for genome editing in challenging cells

mCRAMP, mouse - ANA61305 - 1 mg - AnaSpec - proteins & peptides

mCRAMP, mouse
print page
Size: 1 mg
£392.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61305
Name:
mCRAMP, mouse
Supplier:
Availability:

This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3878.7
Reference:
Limura, M. et al. J. Immunol. 174, 4901 (2005); Lopez-Garcia, B. et al. J. Invest. Dermatol. 125, 108 (2005).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team