Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Human Cell Expressed Proteins
Over 40,000 Peptides & Proteins Available

Calcitonin, salmon - ANA20678 - 5 mg - AnaSpec - proteins & peptides

Calcitonin, salmon
print page
Size: 5 mg
£619.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20678
Name:
Calcitonin, salmon
Supplier:
Availability:

A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
3431.9
Reference:
Andreotti, G. et al. J Biol Chem 281, 24193 (2006), doi: 10.1074/jbc.M603528200
UNSPSC Code:
12352202