Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
High Quality Leukaemia & Lymphoma Blood & Bone Marrow Samples
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

Big Endothelin 1 (1-39), porcine - ANA20715 - 1 mg - AnaSpec - proteins & peptides

Big Endothelin 1 (1-39), porcine
print page
Size: 1 mg
£768.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20715
Name:
Big Endothelin 1 (1-39), porcine
Supplier:
Availability:

This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4384.1
Reference:
Xu D. et al. Cell, 78(3):473-484 (1994).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team