Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Calcitonin, Human - ANA20673 - 1 mg - AnaSpec - proteins & peptides

Calcitonin, Human
print page
Size: 1 mg
£179.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20673
Name:
Calcitonin, Human
Supplier:
Availability:

Human calcitonin stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
3417.9
Reference:
Raddino, R. et al. J. Cardiovas. Pharmacol. 29, 463 (1997); Rotella, C. et al. Eur. J. Pharmacol. 107, 347 (1985); Moriarty, et al. Biochem Biophys Res. Commun. 245, 344 (1998); Chen, W. et al. Mol. Pharmacol. 52, 1164 (1997).
UNSPSC Code:
12352202
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents