Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Fastest 16S Library Prep - Quick-16S™ NGS Library Prep Kit
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Beta-Amyloid (1-40) • HCl, Human - ANA20698 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40) • HCl, Human
print page
Size: 1 mg
£384.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20698
Name:
Beta-Amyloid (1-40) • HCl, Human
Supplier:
Availability:

All the HCl salt forms of Aβ (1-40), Aβ (25-35) and D-Ser26 Aβ (25-35), take the β-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4329.936
Reference:
Kaneko, I. et al. Nippon Yakurigaku Zasshi. 115, 67 (2000).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team