EP4 Receptor (C-Term) Blocking Peptide
Catalogue number:
CAY301775-200 ug
Supplier:
Size:
200 µg
Product is available in:
£167.00
Estimated delivery Wed 24 Dec
Shipping is calculated in checkout
Shipping is calculated in checkout
Alternative Names:
pge2 receptor 4, prostaglandin e2 receptor 4
- MSDS: View or download
Product Description:
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.