www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

Bovine IL-17A Recombinant Protein

Catalogue number:
RP0056B-100
Supplier:
Size:
100 µg
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£1057.00 Estimated delivery Wed 15 Oct
Shipping is calculated in checkout

The Bovine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: (KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA) (Gene ID: 282863). For research use only. Made in the USA