Bovine IL-17A Recombinant Protein
                            Catalogue number:
                        
                        
                                                            
                                                        RP0056B-100
                        
                    
                            Supplier:
                        
                        
                    
                            Size:
                        
                        
                            100 µg                                                            
                        
                    
                            Product is available in:
                        
                        
                                                        £1057.00
                            
                            
                                                                    Estimated delivery Wed 5 Nov                                    
                                    
Shipping is calculated in checkout
                                    Shipping is calculated in checkout
The Bovine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: (KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA) (Gene ID: 282863). For research use only. Made in the USA




