Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Rapid & Complete DNA Bisulphite Conversion Kits
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Achieve High Yield Mammalian Protein Production In Suspension HEK 293 & CHO Derived Cells

3 x Hemagglutinin (HA) Tag - ANA63764 - 1 mg - AnaSpec - proteins & peptides

3 x Hemagglutinin (HA) Tag
print page
Size: 1 mg
£494.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA63764
Name:
3 x Hemagglutinin (HA) Tag
Supplier:
Availability:

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4372.7
Reference:
Kang, Y. et al. J. Biol. Chem. 281, 19019 (2006).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team