Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Cardiosight-S®
Over 40,000 Peptides & Proteins Available

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Secretoneurin - ANA62673 - 1 mg - AnaSpec - proteins & peptides

Secretoneurin
print page
Size: 1 mg
£407.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62673
Name:
Secretoneurin
Supplier:
Availability:

This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenicCytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3652
Reference:
Kirchmair R, et al. Neurosci. 53, 359 (1993); Kirchmair R, et al. Circulation 110, 1121 (2004); Fälth, M. et al. Mol. Cell. Proteom. 5, 998 (2006).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Lena Biosciences