Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search

ETS-Embryo Media

Over 40,000 Peptides & Proteins Available
Achieve High Yield Mammalian Protein Production In Suspension HEK 293 & CHO Derived Cells

TAT-NSF700scr - ANA62209 - 1 mg - AnaSpec - proteins & peptides

TAT-NSF700scr
print page
Size: 1 mg
£439.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62209
Name:
TAT-NSF700scr
Supplier:
Availability:

This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
Storage Temp:
-20°C
Molecular Weight:
4109.9
Reference:
Morrell, C. et al. JPET 314, 155 (2005).
UNSPSC Code:
12352202
Contact Our Customer Service Team
Lena Biosciences