Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Quantibody® Cancer Biomarker Arrays
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

GIP (3-42), human - ANA61227 - 1 mg - AnaSpec - proteins & peptides

GIP (3-42), human
print page
Size: 1 mg
£471.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61227
Name:
GIP (3-42), human
Supplier:
Availability:

This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4759.4
Reference:
Gault, VA. et al. Endocrinol 175, 525 (2002), doi: 10.1677/joe.0.1750525
UNSPSC Code:
12352202
Contact Our Customer Service Team