Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
GLP Compliant Safety Pharmacology Services
Find Your Peptide Simply with Our Peptide Search

Upgrading Your Laser Scanner? Consider The Sapphire™

Adrenomedullin (22-52), human - ANA60449 - 0.5 mg - AnaSpec - proteins & peptides

Adrenomedullin (22-52), human
print page
Size: 0.5 mg
£239.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60449
Name:
Adrenomedullin (22-52), human
Supplier:
Availability:

AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3576
Reference:
Ref: Hyvelin, JM. et al. J. Card Surg. 17, 328 (2002); Ziolkowska, A. et al. Int. J. Mol. Med. 11, 613 (2003); Nishimatsu, H. et al. Hypertens. Res. 26 Suppl, S79 (2003).
UNSPSC Code:
12352202