Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Gibson Assembly® Kits
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Highly effective & efficient in vitro delivery of Cas9 RNP for genome editing in challenging cells

Adrenomedullin (1-52), human - ANA60447 - 0.5 mg - AnaSpec - proteins & peptides

Adrenomedullin (1-52), human
print page
Size: 0.5 mg
£477.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60447
Name:
Adrenomedullin (1-52), human
Supplier:
Availability:

Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name 'Adrenomedullin.' Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
6028.8
Reference:
Kitamura, K. et al. (1993). Biochem Biophys Res Commun 192, 553, doi: 10.1006/bbrc.1993.1451Hinson, JP. et al. Endocrine Rev 21 (2013), doi: http://dx.doi.org/10.1210/edrv.21.2.0396
UNSPSC Code:
12352202
Contact Our Customer Service Team