Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
GPCR & Ion Channel Stable Cell Libes
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

Adrenomedullin (1-52), human - ANA60447 - 0.5 mg - AnaSpec - proteins & peptides

Adrenomedullin (1-52), human
print page
Size: 0.5 mg
£442.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60447
Name:
Adrenomedullin (1-52), human
Supplier:
Availability:

Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name 'Adrenomedullin.' Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
6028.8
Reference:
Kitamura, K. et al. (1993). Biochem Biophys Res Commun 192, 553, doi: 10.1006/bbrc.1993.1451Hinson, JP. et al. Endocrine Rev 21 (2013), doi: http://dx.doi.org/10.1210/edrv.21.2.0396
UNSPSC Code:
12352202