Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
3D Collagen Matrix Cell Contraction Assay

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

PEP1 - ANA60430-1 - 1 mg - AnaSpec - proteins & peptides

PEP1
print page
Size: 1 mg
£384.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60430-1
Name:
PEP1
Supplier:
Availability:

This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3805.3
Reference:
Ref: Glenn, JS. et al. J. Virol. 77, 6055 (2003).
UNSPSC Code:
12352202
Tonbo Biosciences