Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Fluorogenic Mitochondrial Stains For Live Cells
Over 40,000 Peptides & Proteins Available

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

Amylin (1-37), human, amide - ANA60254-1 - 1 mg - AnaSpec - proteins & peptides

Amylin (1-37), human, amide
print page
Size: 1 mg
£317.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60254-1
Name:
Amylin (1-37), human, amide
Supplier:
Availability:

Amylin (1-37), human, amide - 1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: 2-7)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3903.3
UNSPSC Code:
12352200
Contact Our Friendly Technical Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents
Tonbo Biosciences