Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
High Quality DNA & RNA Purification From Agarose
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Amylin (1-37), rat, mouse - ANA60253-1 - 1 mg - AnaSpec - proteins & peptides

Amylin (1-37), rat, mouse
print page
Size: 1 mg
£631.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60253-1
Name:
Amylin (1-37), rat, mouse
Supplier:
Availability:

Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3920.5
Reference:
Westermark, P. et al. Proc Natl Acad Sci U S A 87, 5036 (1990); Williamson, JA. and AD. Miranker. Protein Sci 16, 110 (2007). doi: 10.1110/ps.062486907.
UNSPSC Code:
12352200