Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Locus & Sequence Specific 5-hmC Quantification Kits
Over 40,000 Peptides & Proteins Available

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Beta-Amyloid (1-37), Human - ANA60251-05 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-37), Human
print page
Size: 0.5 mg
£348.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60251-05
Name:
Beta-Amyloid (1-37), Human
Supplier:
Availability:

Beta-Amyloid (1-37), Human - 0.5 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4074.6
UNSPSC Code:
12352202
Contact Our Friendly Technical Team