Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Optimised 3D Cell Culture Scaffold
Find Your Peptide Simply with Our Peptide Search

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

Beta-Amyloid (5-42), Human - ANA60087-01 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (5-42), Human
print page
Size: 0.1 mg
£204.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60087-01
Name:
Beta-Amyloid (5-42), Human
Supplier:
Availability:

Beta-Amyloid (1-42) and Related Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4051.6
UNSPSC Code:
12352202
Contact Our Customer Service Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents
Tonbo Biosciences