Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
GLP Compliant Safety Pharmacology Services
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Beta-Amyloid (11-40), Human - ANA60017-1 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (11-40), Human
print page
Size: 1 mg
£507.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60017-1
Name:
Beta-Amyloid (11-40), Human
Supplier:
Availability:

Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aβ (11-40/42) within insoluble amyloid pools. The β-secretaseEnzyme or β-amyloid precursor protein-cleavingEnzyme (BACE) generates the N terminus of Aβ, ultimately leading to the production of full-length Aβ (1-40/42) or truncated Aβ (11-40/42). The abundance of Aβ (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3151.7
Reference:
Ref: Huse, JT. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002).
UNSPSC Code:
12352202
Contact Our Customer Service Team