Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Fast & Sensitive Prostaglandin E2 EIA
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Beta-Amyloid (9-42), Human - ANA60084-1 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (9-42), Human
print page
Size: 1 mg
£638.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60084-1
Name:
Beta-Amyloid (9-42), Human
Supplier:
Availability:

Beta-Amyloid (9-42), Human - 1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3556.2
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents