Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Express Cysteinyl Leukotriene EIA Kit

Scrambled-beta-Amyloid (1-42), Human - ANA25383 - 1 mg - AnaSpec - proteins & peptides

Scrambled-beta-Amyloid (1-42), Human
print page
Size: 1 mg
£543.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA25383
Name:
Scrambled-beta-Amyloid (1-42), Human
Supplier:
Availability:

Scramble-beta-Amyloid (1-42)

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Storage Temp:
-20°C
Molecular Weight:
4514.1
UNSPSC Code:
12352202