Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Log Distribution Microbial Community Standard
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid Peptide (1-42), mouse, rat - ANA25381 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid Peptide (1-42), mouse, rat
print page
Size: 0.5 mg
£450.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA25381
Name:
Beta-Amyloid Peptide (1-42), mouse, rat
Supplier:
Availability:

Beta-Amyloid Peptide (1-42), mouse, rat - 0.5 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4418
UNSPSC Code:
12352202