Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Sensitive cAMP Quantification EIA Kit

Beta-Amyloid (1-43), Human - ANA25357 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-43), Human
print page
Size: 1 mg
£739.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA25357
Name:
Beta-Amyloid (1-43), Human
Supplier:
Availability:

Solid Aß (1-43) fibril is the most fibrillogenic of all the Aß peptides known.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Storage Temp:
-20°C
Molecular Weight:
4615.2
UNSPSC Code:
12352202