Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Same Day Delivered Fresh Human Blood
Find Your Peptide Simply with Our Peptide Search

Beta-Amyloid (1-40), FAM-labeled, Human - ANA23514-01 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40), FAM-labeled, Human
print page
Size: 0.1 mg
£171.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23514-01
Name:
Beta-Amyloid (1-40), FAM-labeled, Human
Supplier:
Availability:

This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Molecular Weight:
4688.2
Reference:
Prior, R. et al. Am. J. Pathol. 148, 1749 (1996).
UNSPSC Code:
12352202