Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
3D Collagen Matrix Cell Contraction Assay

Beta-Amyloid (1-40), FAM-labeled, Human - ANA23513-05 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40), FAM-labeled, Human
print page
Size: 0.5 mg
£619.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23513-05
Name:
Beta-Amyloid (1-40), FAM-labeled, Human
Supplier:
Availability:

This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Molecular Weight:
4688.2
UNSPSC Code:
12352202