Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Low Input DNA Fragment Library Prep Kit
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid (1-42), FAM-labeled, Human - ANA23525-05 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-42), FAM-labeled, Human
print page
Size: 0.5 mg
£797.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23525-05
Name:
Beta-Amyloid (1-42), FAM-labeled, Human
Supplier:
Availability:

This is a fluorescent (FAM)-labeled β-Amyloid peptide, Abs/Em=494/521 nm.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4873.4
Reference:
Ref: Wei, H. et al. J. Pharmacol. 392, 117 (2000).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team