Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
3D Collagen Matrix Cell Contraction Assay

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Neuropeptide Y, human, rat - ANA22465 - 1 mg - AnaSpec - proteins & peptides

Neuropeptide Y, human, rat
print page
Size: 1 mg
£239.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22465
Name:
Neuropeptide Y, human, rat
Supplier:
Availability:

Neuropeptide Y, human, rat - 1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4271.8
Reference:
Ref: Minth, C. et al. Proc. Natl. Acad. Sci. USA 81, 4577 (1984).
UNSPSC Code:
12352202