Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Galanin, Human - ANA22431 - 1 mg - AnaSpec - proteins & peptides

Galanin, Human
print page
Size: 1 mg
£306.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22431
Name:
Galanin, Human
Supplier:
Availability:

Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Storage Temp:
-20°C
Molecular Weight:
3157.5
Reference:
Wang, S. et al. J. Biol. Chem. 272, 31949 (1997).
UNSPSC Code:
12352202
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents