Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Antigens To Complement Atlas Antibodies

Amylin (8-37), Rat - ANA21749 - 1 mg - AnaSpec - proteins & peptides

Amylin (8-37), Rat
print page
Size: 1 mg
£312.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA21749
Name:
Amylin (8-37), Rat
Supplier:
Availability:

This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
3200.6
Reference:
Deems, RO. et al. Biochem. Biophys. Res. Commun. 181, 116 (1991); Hettiarachchi, M. et al. Am. J. Physiol. Endocrinol. Metab. 273, E859 (1997).
UNSPSC Code:
12352202