AIF Blocking Peptide
Catalogue number:
CAY360773-1 ea
Supplier:
Size:
1 each _$$_
Product is available in:
£172.00
Estimated delivery Wed 29 May
Shipping is calculated in checkout
Shipping is calculated in checkout
Alternative Names:
apoptosis-inducing factor, programmed cell death protein 8
- Data sheet: View or download
- MSDS: View or download
Product Description:
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.
Storage Temperature:
-20°C