Prostaglandin I Synthase Blocking Peptide
Catalogue number:
CAY360640-200 ug
Supplier:
Size:
200 µg _$$_
Product is available in:
£172.00
Estimated delivery Tue 28 May
Shipping is calculated in checkout
Shipping is calculated in checkout
Alternative Names:
pgi synthase, pgis, prostacyclin synthase
- Data sheet: View or download
- MSDS: View or download
Product Description:
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT){3477,3476,3478} · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.
Storage Temperature:
-20°C