Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Cell Transformation Assays With No Manual Cell Counting
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Human - ANA62465 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Human
print page
Size: 0.5 mg
£345.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62465
Name:
Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Human
Supplier:
Availability:

This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3616
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Tonbo Biosciences