Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Lentiviral Packaging, Concentration & Titering Kit
Over 40,000 Peptides & Proteins Available

PACAP (1-27), amide, Human, ovine, Rat - ANA22527 - 0.5 mg - AnaSpec - proteins & peptides

PACAP (1-27), amide, Human, ovine, Rat
print page
Size: 0.5 mg
£171.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22527
Name:
PACAP (1-27), amide, Human, ovine, Rat
Supplier:
Availability:

PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Storage Temp:
-20°C
Molecular Weight:
3147.7
Reference:
Miyata, A. et al. BBRC 164, 567(1998); Chik, C. et al. J. Neurochem. 67, 1005 (1996).
UNSPSC Code:
12352202