www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen DPY19L2

Catalogue number:
APrEST90334
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen DPY19L2, Gene description: dpy-19-like 2 (C. elegans), Alternative Gene Names: FLJ32949, SPATA34, Antigen sequence: KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-DPY19L2 HPA071264 · Atlas Antibodies
HPA071264
Atlas Antibodies
100 µl £438.00
100 µl
view
Anti-DPY19L2 HPA078305 · Atlas Antibodies
HPA078305
Atlas Antibodies
100 µl £438.00
100 µl
view